F-box and leucine-rich repeat protein 5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-586	50 μL

Catalog No. 89-004-586 Supplier Abnova Corporation Supplier No. H00026234A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBXL5.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq]

Sequence: LIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE

Specifications

• Antigen: F-box and leucine-rich repeat protein 5
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXL5.
• Formulation: 50% glycerol
• Gene: FBXL5
• Gene Accession No.: NM_012161
• Gene Alias: FBL4/FBL5/FLR1
• Gene Symbols: FBXL5
• Host Species: Mouse
• Immunogen: FBXL5 (NP_036293, 584 a.a. ∼ 691 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 26234
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum