F-box protein 11, Mouse, Clone: 4C12, Abnova™

Catalog No.	Quantity
89-014-337	100 μg

Catalog No. 89-014-337 Supplier Abnova Corporation Supplier No. H00080204M01

Description

Mouse monoclonal antibody raised against a partial recombinant FBXO11.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN

Specifications

• Antigen: F-box protein 11
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4C12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FBXO11.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FBXO11
• Gene Accession No.: NM_025133
• Gene Alias: FBX11/FLJ12673/MGC44383/PRMT9/UBR6/UG063H01/VIT1
• Gene Symbols: FBXO11
• Host Species: Mouse
• Immunogen: FBXO11 (NP_079409, 744 a.a. ∼ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Primary or Secondary: Primary
• Gene ID (Entrez): 80204
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ