Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

F-box protein 30 (A01), Mouse anti-Human, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FBXO30.

Manufacturer:  Abnova Corporation H00084085A01

Catalog No. 89-004-738


Add to cart

Description

Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it is upregulated in nasopharyngeal carcinoma. [provided by RefSeq

Sequence: MVILQWGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNVVEKREEAIPLPCMCVTRELTKEGRSLRSVLKPVL
Specifications

Specifications

F-box protein 30
Unconjugated
50% glycerol
NM_032145
FLJ41030|Fbx30|MGC21674
Mouse
50 uL
Ubiquitin/Proteasome
Y
Polyclonal
Human, Rat
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant FBXO30.
FBXO30
Serum
FBXO30
FBXO30 (NP_115521, 656 a.a. ~ 745 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
84085
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit