F-box protein 30 (A01), Mouse anti-Human, Rat, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-738	50 μL

Catalog No. 89-004-738 Supplier Abnova Corporation Supplier No. H00084085A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBXO30.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it is upregulated in nasopharyngeal carcinoma. [provided by RefSeq]

Sequence: MVILQWGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNVVEKREEAIPLPCMCVTRELTKEGRSLRSVLKPVL

Specifications

• Antigen: F-box protein 30
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXO30.
• Formulation: 50% glycerol
• Gene: FBXO30
• Gene Accession No.: NM_032145
• Gene Alias: FLJ41030/Fbx30/MGC21674
• Gene Symbols: FBXO30
• Host Species: Mouse
• Immunogen: FBXO30 (NP_115521, 656 a.a. ∼ 745 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 84085
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum