F-box protein 33, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FBXO33.

Supplier:  Abnova Corporation H00254170A01

Catalog No. 89-004-824

Description

Members of the F-box protein family, such as FBXO33, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Sequence: RNNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTL

Specifications

• Antigen: F-box protein 33
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXO33.
• Gene: FBXO33
• Gene Alias: Fbx33/c14_5247
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Ubiquitin/Proteasome
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_203301
• Gene Symbols: FBXO33
• Immunogen: FBXO33 (NP_976046, 197 a.a. ∼ 296 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 254170
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.