Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

F-box protein 33, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FBXO33.

Manufacturer:  Abnova Corporation H00254170A01

Catalog No. 89-004-824


Add to cart

Description

Description

Members of the F-box protein family, such as FBXO33, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Sequence: RNNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTL
Specifications

Specifications

F-box protein 33
Unconjugated
50% glycerol
NM_203301
Fbx33|c14_5247
Mouse
50 uL
Ubiquitin/Proteasome
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant FBXO33.
FBXO33
Serum
FBXO33
FBXO33 (NP_976046, 197 a.a. ~ 296 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
254170
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit