F-box protein 6, Mouse, Clone: 7D1, Abnova™

Catalog No.	Quantity
89-001-533	200 μL

Catalog No. 89-001-533 Supplier Abnova Corporation Supplier No. H00026270M02A

Description

Mouse monoclonal antibody raised against a full-length recombinant FBXO6.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42kDa) which may be involved in the control of the cell cycle. [provided by RefSeq]

Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF

Specifications

• Antigen: F-box protein 6
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 7D1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant FBXO6.
• Formulation: ascites with no preservative
• Gene: FBXO6
• Gene Accession No.: BC020880
• Gene Alias: FBG2/FBS2/FBX6/Fbx6b
• Gene Symbols: FBXO6
• Host Species: Mouse
• Immunogen: FBXO6 (AAH20880.1, 1 a.a. ∼ 293 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 26270
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ