F-box and WD repeat domain containing 11, Mouse, Clone: 2E7, Abnova™

Catalog No.	Quantity
89-014-283	100 μg

Catalog No. 89-014-283 Supplier Abnova Corporation Supplier No. H00023291M03

Description

Mouse monoclonal antibody raised against a full-length recombinant FBXW11.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons. [provided by RefSeq]

Sequence: MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR

Specifications

• Antigen: F-box and WD repeat domain containing 11
• Applications: ELISA, Immunofluorescence, In situ PLA
• Classification: Monoclonal
• Clone: 2E7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant FBXW11.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FBXW11
• Gene Accession No.: BC026213
• Gene Alias: BTRC2/BTRCP2/FBW1B/FBXW1B/Fbw11/Hos/KIAA0696
• Gene Symbols: FBXW11
• Host Species: Mouse
• Immunogen: FBXW11 (AAH26213, 1 a.a. ∼ 529 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Gene ID (Entrez): 23291
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ