F-box and WD repeat domain containing 8, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-587	50 μL

Catalog No. 89-004-587 Supplier Abnova Corporation Supplier No. H00026259A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBXW8.

This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV

Specifications

• Antigen: F-box and WD repeat domain containing 8
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXW8.
• Formulation: 50% glycerol
• Gene: FBXW8
• Gene Accession No.: NM_153348
• Gene Alias: FBW6/FBW8/FBX29/FBXO29/FBXW6/MGC33534
• Gene Symbols: FBXW8
• Host Species: Mouse
• Immunogen: FBXW8 (NP_699179, 499 a.a. ∼ 598 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 26259
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum