Fc fragment of IgE, low affinity II, receptor for (CD23), Mouse, Clone: S52, Abnova™

Catalog No.	Quantity
89-000-651	100 μg

Catalog No. 89-000-651 Supplier Abnova Corporation Supplier No. H00002208M03

Description

Mouse monoclonal antibody raised against a full-length recombinant FCER2.

The human leukocyte differentiation antigen CD23 (FCE2) is a key molecule for B-cell activation and growth. It is the low-affinity receptor for IgE. The truncated molecule can be secreted, then functioning as a potent mitogenic growth factor.[supplied by OMIM

Sequence: MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQGLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Specifications

• Antigen: Fc fragment of IgE, low affinity II, receptor for (CD23)
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: S52
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant FCER2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FCER2
• Gene Accession No.: BC014108
• Gene Alias: CD23/CD23A/CLEC4J/FCE2/IGEBF
• Gene Symbols: FCER2
• Host Species: Mouse
• Immunogen: FCER2 (AAH14108, 1 a.a. ∼ 321 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2208
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ