Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FCGR1A, Mouse, Clone: 1D3, Abnova™

Catalog No. 89022068 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-068 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-068 Supplier Abnova Corporation Supplier No. H00002209M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant FCGR1A.

This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. [provided by RefSeq

Sequence: QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT

Specifications

Antigen FCGR1A
Applications ELISA, In situ PLA
Classification Monoclonal
Clone 1D3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FCGR1A.
Formulation PBS with no preservative; pH 7.4
Gene FCGR1A
Gene Accession No. NM_000566
Gene Alias CD64/CD64A/FCRI/FLJ18345/IGFR1
Gene Symbols FCGR1A
Host Species Mouse
Immunogen FCGR1A (NP_000557, 16 a.a. ∼ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2209
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.