myoferlin, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-588	50 μL

Catalog No. 89-004-588 Supplier Abnova Corporation Supplier No. H00026509A01

Description

Mouse polyclonal antibody raised against a partial recombinant FER1L3.

Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length nature has not been determined. [provided by RefSeq

Sequence: DAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEI

Specifications

• Antigen: myoferlin
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FER1L3.
• Formulation: 50% glycerol
• Gene: MYOF
• Gene Accession No.: NM_013451
• Gene Alias: FER1L3/FLJ36571/FLJ90777
• Gene Symbols: MYOF
• Host Species: Mouse
• Immunogen: FER1L3 (NP_038479, 655 a.a. ∼ 754 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 26509
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum