FGFR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP188670

Catalog No. NBP188670

Description

FGFR2 Polyclonal specifically detects FGFR2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FGFR2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P21802
• Gene Symbols: FGFR2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV
• Quantity: 0.1 mL
• Research Discipline: Angiogenesis, Protein Kinase
• Gene ID (Entrez): 2263
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human FGF R2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only