Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89005365

fibroblast growth factor 1 (acidic), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89005365 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-005-365 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-005-365 Supplier Abnova Corporation Supplier No. H00002246B01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length human FGF1 protein.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq

Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Specifications

Antigen fibroblast growth factor 1 (acidic)
Applications Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human FGF1 protein.
Formulation No additive
Gene FGF1
Gene Accession No. NM_000800
Gene Alias AFGF/ECGF/ECGF-beta/ECGFA/ECGFB/FGF-alpha/FGFA/GLIO703/HBGF1
Gene Symbols FGF1
Host Species Mouse
Immunogen FGF1 (NP_000791, 1 a.a. ∼ 155 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Angiogenesis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2246
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.