FGF12, Mouse, Clone: 1D9, Abnova™

Catalog No.	Quantity
89-022-086	100 μg

Catalog No. 89-022-086 Supplier Abnova Corporation Supplier No. H00002257M10

Description

Mouse monoclonal antibody raised against a full-length recombinant FGF12.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Specifications

• Antigen: FGF12
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1D9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant FGF12.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FGF12
• Gene Accession No.: BC022524
• Gene Alias: FGF12B/FHF1
• Gene Symbols: FGF12
• Host Species: Mouse
• Immunogen: FGF12 (AAH22524, 1 a.a. ∼ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2257
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ