FGF14, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-275	50 μL

Catalog No. 89-003-275 Supplier Abnova Corporation Supplier No. H00002259A01

Description

Mouse polyclonal antibody raised against a partial recombinant FGF14.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Sequence: LFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Specifications

• Antigen: FGF14
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FGF14.
• Formulation: 50% glycerol
• Gene: FGF14
• Gene Accession No.: NM_004115
• Gene Alias: FHF4/MGC119129/SCA27
• Gene Symbols: FGF14
• Host Species: Mouse
• Immunogen: FGF14 (NP_004106, 138 a.a. ∼ 247 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2259
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid