fibroblast growth factor 18, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-016-955	50 μg

Catalog No. 89-016-955 Supplier Abnova Corporation Supplier No. H00008817B01P

Description

Mouse polyclonal antibody raised against a full-length human FGF18 protein.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures. [provided by RefSeq

Sequence: MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA

Specifications

• Antigen: fibroblast growth factor 18
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human FGF18 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FGF18
• Gene Accession No.: NM_003862
• Gene Alias: FGF-18/ZFGF5
• Gene Symbols: FGF18
• Host Species: Mouse
• Immunogen: FGF18 (NP_003853.1, 1 a.a. ∼ 207 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 8817
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG