fibroblast growth factor receptor 2, Mouse, Clone: 1G3, Abnova™

Catalog No.	Quantity
89-014-111	100 μg

Catalog No. 89-014-111 Supplier Abnova Corporation Supplier No. H00002263M01

Description

Mouse monoclonal antibody raised against a partial recombinant FGFR2.

The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq

Sequence: GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT

Specifications

• Antigen: fibroblast growth factor receptor 2
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1G3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FGFR2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FGFR2
• Gene Accession No.: BC039243
• Gene Alias: BEK/BFR-1/CD332/CEK3/CFD1/ECT1/FLJ98662/JWS/K-SAM/KGFR/TK14/TK25
• Gene Symbols: FGFR2
• Host Species: Mouse
• Immunogen: FGFR2 (AAH39243, 621 a.a. ∼ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Gene ID (Entrez): 2263
• Test Specificity: This antibody cross-reacts with human FGFR1 and human FGFR3.
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ