FGL1, Mouse, Clone: 2A4, Abnova™

Catalog No.	Quantity
89-022-098	100 μg

Catalog No. 89-022-098 Supplier Abnova Corporation Supplier No. H00002267M01

Description

Mouse monoclonal antibody raised against a full-length recombinant FGL1.

Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq

Sequence: EISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Specifications

• Antigen: FGL1
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 2A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant FGL1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FGL1
• Gene Accession No.: BC007047
• Gene Alias: HFREP1/HP-041/LFIRE1/MGC12455
• Gene Symbols: FGL1
• Host Species: Mouse
• Immunogen: FGL1 (AAH07047.1, 19 a.a. ∼ 312 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2267
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ