FGR, Mouse, Clone: 1B12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FGR.

Supplier:  Abnova Corporation H00002268M03

Catalog No. 89-022-100

Description

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq

Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA

Specifications

• Antigen: FGR
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC064382
• Gene Symbols: FGR
• Immunogen: FGR (AAH64382, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1B12
• Description: Mouse monoclonal antibody raised against a partial recombinant FGR.
• Gene: FGR
• Gene Alias: FLJ43153/MGC75096/SRC2/c-fgr/c-src2/p55c-fgr/p58c-fgr
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2268
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid