FHIT, Mouse, Clone: 3A5, Abnova™

Catalog No.	Quantity
89-022-113	100 μg

Catalog No. 89-022-113 Supplier Abnova Corporation Supplier No. H00002272M09

Description

Mouse monoclonal antibody raised against a partial recombinant FHIT.

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5‴-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. [provided by RefSeq]

Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR

Specifications

• Antigen: FHIT
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3A5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FHIT.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FHIT
• Gene Accession No.: BC032336
• Gene Alias: AP3Aase/FRA3B
• Gene Symbols: FHIT
• Host Species: Mouse
• Immunogen: FHIT (AAH32336, 31 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2272
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ