Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant TTC11.

Manufacturer:  Abnova Corporation H00051024A01

Catalog No. 89-004-618


Add to cart

Description

Description

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM

Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Specifications

Specifications

fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Unconjugated
50% glycerol
BC003540
CGI-135|TTC11
Mouse
50 uL
Apoptosis
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a full-length recombinant TTC11.
FIS1
Serum
FIS1
TTC11 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
51024
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit