Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FKBP1B, Mouse, Clone: 4H5-1B6, Abnova™

Catalog No. 89022119 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-119 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-119 Supplier Abnova Corporation Supplier No. H00002281M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant FKBP1B.

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq

Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC

Specifications

Antigen FKBP1B
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4H5-1B6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant FKBP1B.
Formulation PBS with no preservative; pH 7.4
Gene FKBP1B
Gene Accession No. BC002614
Gene Alias FKBP12.6/FKBP1L/OTK4/PKBP1L/PPIase
Gene Symbols FKBP1B
Host Species Mouse
Immunogen FKBP1B (AAH02614, 1 a.a. ∼ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2281
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.