Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89017158

FLJ13912, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89017158 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-017-158 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-017-158 Supplier Abnova Corporation Supplier No. H00064785B01P
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length human FLJ13912 protein.

This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Sequence: MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYSEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED

Specifications

Antigen FLJ13912
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human FLJ13912 protein.
Formulation PBS with no preservative; pH 7.4
Gene GINS3
Gene Accession No. BC005879
Gene Alias FLJ13912/PSF3
Gene Symbols GINS3
Host Species Mouse
Immunogen FLJ13912 (AAH05879, 1 a.a. ∼ 216 a.a) full-length human protein.
Purification Method Affinity chromatography
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64785
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.