filamin C, gamma (actin binding protein 280), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FLNC.

Supplier:  Abnova Corporation H00002318A01

Catalog No. 89-004-126

Description

This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP

Specifications

• Antigen: filamin C, gamma (actin binding protein 280)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant FLNC.
• Gene: FLNC
• Gene Alias: ABP-280/ABP280A/ABPA/ABPL/FLJ10186/FLN2
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 2318
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001458
• Gene Symbols: FLNC
• Immunogen: FLNC (NP_001449.3, 2606 a.a. ∼ 2705 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Serum