FLT4, Mouse, Clone: 5F11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FLT4.

Supplier:  Abnova Corporation H00002324M02

Catalog No. 89-022-192

Description

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq

Sequence: ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR

Specifications

• Antigen: FLT4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002020
• Gene Symbols: FLT4
• Immunogen: FLT4 (NP_002011, 34 a.a. ∼ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 5F11
• Description: Mouse monoclonal antibody raised against a partial recombinant FLT4.
• Gene: FLT4
• Gene Alias: FLT41/LMPH1A/PCL/VEGFR3
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2324
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid