FMR1, Mouse, Clone: 3E11, Abnova™

Catalog No.	Quantity
89-022-199	100 μg

Catalog No. 89-022-199 Supplier Abnova Corporation Supplier No. H00002332M03

Description

Mouse monoclonal antibody raised against a partial recombinant FMR1.

The protein encoded by this gene binds RNA and is associated with polysomes. The encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). [provided by RefSeq]

Sequence: ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH

Specifications

• Antigen: FMR1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FMR1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FMR1
• Gene Accession No.: NM_002024
• Gene Alias: FMRP/FRAXA/MGC87458/POF/POF1
• Gene Symbols: FMR1
• Host Species: Mouse
• Immunogen: FMR1 (NP_002015, 121 a.a. ∼ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2332
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ