Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOSL2, Mouse, Clone: 2B4-1C2, Abnova™

Catalog No. 89022202 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-202 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-202 Supplier Abnova Corporation Supplier No. H00002355M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant FOSL2.

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq

Sequence: MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC

Specifications

Antigen FOSL2
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2B4-1C2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant FOSL2.
Formulation PBS with no preservative; pH 7.4
Gene FOSL2
Gene Accession No. BC008899
Gene Alias FLJ23306/FRA2
Gene Symbols FOSL2
Host Species Mouse
Immunogen FOSL2 (AAH08899, 1 a.a. ∼ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2355
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.