forkhead box A2, Mouse, Clone: 1C7, Abnova™

Catalog No.	Quantity
89-000-721	100 μg

Catalog No. 89-000-721 Supplier Abnova Corporation Supplier No. H00003170M10

Description

Mouse monoclonal antibody raised against a partial recombinant FOXA2.

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

Specifications

• Antigen: forkhead box A2
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 1C7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FOXA2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FOXA2
• Gene Accession No.: NM_021784
• Gene Alias: HNF3B/MGC19807/TCF3B
• Gene Symbols: FOXA2
• Host Species: Mouse
• Immunogen: FOXA2 (NP_068556, 363 a.a. ∼ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3170
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ