Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

forkhead box A2, Mouse, Clone: 7E6, Abnova™

Catalog No. 89019034 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-019-034 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-019-034 Supplier Abnova Corporation Supplier No. H00003170M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant FOXA2.

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

Specifications

Antigen forkhead box A2
Applications ELISA, Immunofluorescence, Immunoprecipitation, KnockDown, Western Blot
Classification Monoclonal
Clone 7E6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FOXA2.
Formulation PBS with no preservative; pH 7.4
Gene FOXA2
Gene Accession No. NM_021784
Gene Alias HNF3B/MGC19807/TCF3B
Gene Symbols FOXA2
Host Species Mouse
Immunogen FOXA2 (NP_068556, 363 a.a. ∼ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Primary or Secondary Primary
Gene ID (Entrez) 3170
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.