Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOXC1, Mouse, Clone: 1E11, Abnova™

Catalog No. 89022130 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-130 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-130 Supplier Abnova Corporation Supplier No. H00002296M09
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant FOXC1.

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq

Sequence: AAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF*

Specifications

Antigen FOXC1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1E11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant FOXC1.
Formulation PBS with no preservative; pH 7.4
Gene FOXC1
Gene Accession No. NM_001453
Gene Alias ARA/FKHL7/FREAC-3/FREAC3/IGDA/IHG1/IRID1
Gene Symbols FOXC1
Host Species Mouse
Immunogen FOXC1 (NP_001444, 464 a.a. ∼ 553 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2296
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.