forkhead box C1, Mouse, Clone: 4D11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant FOXC1.

Supplier:  Abnova Corporation H00002296M05

Catalog No. 89-000-663

Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq

Sequence: AAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF*

Specifications

• Antigen: forkhead box C1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001453
• Gene Symbols: FOXC1
• Immunogen: FOXC1 (NP_001444, 464 a.a. ∼ 553 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4D11
• Description: Mouse monoclonal antibody raised against a full length recombinant FOXC1.
• Gene: FOXC1
• Gene Alias: ARA/FKHL7/FREAC-3/FREAC3/IGDA/IHG1/IRID1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2296
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ