Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022131

FOXD1, Mouse, Clone: 2C10, Abnova™

Catalog No. 89022131 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-131 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-131 Supplier Abnova Corporation Supplier No. H00002297M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant FOXD1.

This intronless gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in tumor formation. [provided by RefSeq

Sequence: MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPP

Specifications

Antigen FOXD1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2C10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FOXD1.
Formulation PBS with no preservative; pH 7.4
Gene FOXD1
Gene Accession No. NM_004472
Gene Alias FKHL8/FREAC4
Gene Symbols FOXD1
Host Species Mouse
Immunogen FOXD1 (NP_004463, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2297
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.