Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

forkhead box F2, Mouse, Clone: 2G10, Abnova™

Catalog No. 89000662 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-662 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-662 Supplier Abnova Corporation Supplier No. H00002295M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant FOXF2.

FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq

Sequence: SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV

Specifications

Antigen forkhead box F2
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2G10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FOXF2.
Formulation PBS with no preservative; pH 7.4
Gene FOXF2
Gene Accession No. NM_001452
Gene Alias FKHL6/FREAC2
Gene Symbols FOXF2
Host Species Mouse
Immunogen FOXF2 (NP_001443, 346 a.a. ∼ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2295
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.