Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOXM1, Mouse, Clone: 2H4, Abnova™

Catalog No. 89022152 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-152 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-152 Supplier Abnova Corporation Supplier No. H00002305M05
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant FOXM1.

Sequence: NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS

Specifications

Antigen FOXM1
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2H4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant FOXM1.
Formulation PBS with no preservative; pH 7.4
Gene FOXM1
Gene Accession No. NM_202002
Gene Alias FKHL16/FOXM1B/HFH-11/HFH11/HNF-3/INS-1/MPHOSPH2/MPP-2/MPP2/PIG29/TGT3/TRIDENT
Gene Symbols FOXM1
Host Species Mouse
Immunogen FOXM1 (NP_973731, 22 a.a. ∼ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2305
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.