FOXO1A, Mouse, Clone: 1F6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FOXO1A.

Supplier:  Abnova Corporation H00002308M07

Catalog No. 89-022-161

Description

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq

Sequence: TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Specifications

• Antigen: FOXO1A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002015
• Gene Symbols: FOXO1
• Immunogen: FOXO1A (NP_002006, 556 a.a. ∼ 655 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 1F6
• Description: Mouse monoclonal antibody raised against a partial recombinant FOXO1A.
• Gene: FOXO1
• Gene Alias: FKH1/FKHR/FOXO1A
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2308
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid