Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022158

FOXO1A, Mouse, Clone: 4A2, Abnova™

Catalog No. 89022158 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-158 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-158 Supplier Abnova Corporation Supplier No. H00002308M04
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant FOXO1A.

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq

Sequence: TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Specifications

Antigen FOXO1A
Applications ELISA, Immunofluorescence
Classification Monoclonal
Clone 4A2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FOXO1A.
Formulation PBS with no preservative; pH 7.4
Gene FOXO1
Gene Accession No. NM_002015
Gene Alias FKH1/FKHR/FOXO1A
Gene Symbols FOXO1
Host Species Mouse
Immunogen FOXO1A (NP_002006, 556 a.a. ∼ 655 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2308
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.