Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOXO3A, Mouse, Clone: 4F2, Abnova™

Catalog No. 89022171 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-171 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-171 Supplier Abnova Corporation Supplier No. H00002309M08
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant FOXO3A.

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq

Sequence: PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS

Specifications

Antigen FOXO3A
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 4F2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FOXO3A.
Formulation PBS with no preservative; pH 7.4
Gene FOXO3
Gene Accession No. BC021224
Gene Alias AF6q21/DKFZp781A0677/FKHRL1/FKHRL1P2/FOXO2/FOXO3A/MGC12739/MGC31925
Gene Symbols FOXO3
Host Species Mouse
Immunogen FOXO3A (AAH21224, 361 a.a. ∼ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2309
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.