FOXO3A, Mouse, Clone: 4F2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FOXO3A.

Supplier:  Abnova Corporation H00002309M08

Catalog No. 89-022-171

Description

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq

Sequence: PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS

Specifications

• Antigen: FOXO3A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC021224
• Gene Symbols: FOXO3
• Immunogen: FOXO3A (AAH21224, 361 a.a. ∼ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 4F2
• Description: Mouse monoclonal antibody raised against a partial recombinant FOXO3A.
• Gene: FOXO3
• Gene Alias: AF6q21/DKFZp781A0677/FKHRL1/FKHRL1P2/FOXO2/FOXO3A/MGC12739/MGC31925
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2309
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid