forkhead box Q1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FOXQ1.

Supplier:  Abnova Corporation H00094234A01

Catalog No. 89-004-763

Description

FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM

Sequence: RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR

Specifications

• Antigen: forkhead box Q1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant FOXQ1.
• Gene: FOXQ1
• Gene Alias: HFH1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_033260
• Gene Symbols: FOXQ1
• Immunogen: FOXQ1 (NP_150285, 110 a.a. ∼ 219 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 94234
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.