FK506 binding protein 12-rapamycin associated protein 1, Mouse, Clone: 2C5, Abnova™

Catalog No.	Quantity
89-014-113	100 μg

Catalog No. 89-014-113 Supplier Abnova Corporation Supplier No. H00002475M01

Description

Mouse monoclonal antibody raised against a partial recombinant FRAP1.

The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene. [provided by RefSeq

Sequence: WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW

Specifications

• Antigen: FK506 binding protein 12-rapamycin associated protein 1
• Applications: ELISA, In situ PLA
• Classification: Monoclonal
• Clone: 2C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FRAP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MTOR
• Gene Accession No.: NM_004958
• Gene Alias: FRAP/FRAP1/FRAP2/RAFT1/RAPT1
• Gene Symbols: MTOR
• Host Species: Mouse
• Immunogen: MTOR (NP_004949, 1521 a.a. ∼ 1620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 2475
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ