Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004128

follicle stimulating hormone receptor, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004128 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-128 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-128 Supplier Abnova Corporation Supplier No. H00002492A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant FSHR.

The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq

Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP

Specifications

Antigen follicle stimulating hormone receptor
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant FSHR.
Formulation 50% glycerol
Gene FSHR
Gene Accession No. NM_000145
Gene Alias FSHRO/LGR1/MGC141667/MGC141668/ODG1
Gene Symbols FSHR
Host Species Mouse
Immunogen FSHR (NP_000136, 18 a.a. ∼ 120 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Membrane Receptors
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2492
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.