Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022238

FUT7, Mouse, Clone: 1A12, Abnova™

Catalog No. 89022238 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-238 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-238 Supplier Abnova Corporation Supplier No. H00002529M05
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant FUT7.

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq

Sequence: YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA

Specifications

Antigen FUT7
Applications ELISA
Classification Monoclonal
Clone 1A12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FUT7.
Formulation PBS with no preservative; pH 7.4
Gene FUT7
Gene Accession No. NM_004479
Gene Alias FucT-VII
Gene Symbols FUT7
Host Species Mouse
Immunogen FUT7 (NP_004470, 262 a.a. ∼ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2529
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.