fucosyltransferase 7 (alpha (1,3) fucosyltransferase), Mouse, Clone: 1C12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FUT7.

Supplier:  Abnova Corporation H00002529M03

Catalog No. 89-000-673

Description

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq

Sequence: YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA

Specifications

• Antigen: fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004479
• Gene Symbols: FUT7
• Immunogen: FUT7 (NP_004470, 262 a.a. ∼ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 2529
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 1C12
• Description: Mouse monoclonal antibody raised against a partial recombinant FUT7.
• Gene: FUT7
• Gene Alias: FucT-VII
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody