Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FXN, Mouse, Clone: 3E7, Abnova™

Catalog No. 89022211 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-211 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-211 Supplier Abnova Corporation Supplier No. H00002395M05
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant FXN.

This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL

Specifications

Antigen FXN
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3E7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FXN.
Formulation PBS with no preservative; pH 7.4
Gene FXN
Gene Accession No. NM_000144
Gene Alias CyaY/FA/FARR/FRDA/MGC57199/X25
Gene Symbols FXN
Host Species Mouse
Immunogen FXN (AAH48097.1, 91 a.a. ∼ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2395
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.