Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89005404

Duffy blood group, chemokine receptor, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89005404 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-005-404 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-005-404 Supplier Abnova Corporation Supplier No. H00002532B01

Description

Mouse polyclonal antibody raised against a full-length human FY protein.

The protein encoded by this gene is a glycosylated membrane protein and a nonspecific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS

Specifications

Antigen Duffy blood group, chemokine receptor
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human FY protein.
Formulation No additive
Gene DARC
Gene Accession No. BC017817
Gene Alias CCBP1/CD234/Dfy/FY/GPD/GpFy/WBCQ1
Gene Symbols DARC
Host Species Mouse
Immunogen FY (AAH17817, 1 a.a. ∼ 336 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Membrane Receptors
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2532
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.