Duffy blood group, chemokine receptor, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human FY protein.

Supplier:  Abnova Corporation H00002532B01

Catalog No. 89-005-404

Description

The protein encoded by this gene is a glycosylated membrane protein and a nonspecific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS

Specifications

• Antigen: Duffy blood group, chemokine receptor
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human FY protein.
• Gene: DARC
• Gene Alias: CCBP1/CD234/Dfy/FY/GPD/GpFy/WBCQ1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC017817
• Gene Symbols: DARC
• Immunogen: FY (AAH17817, 1 a.a. ∼ 336 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2532
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.