frizzled homolog 3 (Drosophila), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FZD3.

Manufacturer:  Abnova Corporation H00007976A01

Catalog No. 89-004-374

Description

This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. [provided by RefSeq

Sequence: QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV

Specifications

• Antigen: frizzled homolog 3 (Drosophila)
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_017412
• Gene Alias: Fz-3|hFz3
• Host Species: Mouse
• Quantity: 50 uL
• Research Discipline: Membrane Receptors
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant FZD3.
• Gene: FZD3
• Format: Serum
• Gene Symbols: FZD3
• Immunogen: FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 7976