GABBR1, Mouse, Clone: 2D7, Abnova™

Catalog No.	Quantity
89-022-250	100 μg

Catalog No. 89-022-250 Supplier Abnova Corporation Supplier No. H00002550M01

Description

Mouse monoclonal antibody raised against a partial recombinant GABBR1.

Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. GABA exerts its effects through ionotropic [GABA(A/C)] receptors, to produce fast synaptic inhibition, and metabotropic [GABA(B)] receptors, to produce slow, prolonged inhibitory signals. The GABA(B) receptor consists of a heterodimer of two related 7-transmembrane receptors, GABA(B) receptor 1 and GABA(B) receptor 2. The GABA(B) receptor 1 gene is mapped to chromosome 6p21.3 within the HLA class I region close to the HLA-F gene. Susceptibility loci for multiple sclerosis, epilepsy, and schizophrenia have also been mapped in this region. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq

Sequence: AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG

Specifications

• Antigen: GABBR1
• Applications: ELISA, Immunofluorescence, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 2D7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GABBR1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GABBR1
• Gene Accession No.: BC050532
• Gene Alias: FLJ92613/GABAB(1e)/GABABR1/GABBR1-3/GPRC3A/dJ271M21.1.1/dJ271M21.1.2/hGB1a
• Gene Symbols: GABBR1
• Host Species: Mouse
• Immunogen: GABBR1 (AAH50532, 52 a.a. ∼ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2550
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ