GADD45A, Mouse, Clone: 3D12, Abnova™

Catalog No.	Quantity
89-021-280	100 μg

Catalog No. 89-021-280 Supplier Abnova Corporation Supplier No. H00001647M01

Description

Mouse monoclonal antibody raised against a partial recombinant GADD45A.

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq

Sequence: TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Specifications

• Antigen: GADD45A
• Applications: ELISA, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 3D12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant GADD45A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: GADD45A
• Gene Accession No.: BC011757
• Gene Alias: DDIT1/GADD45
• Gene Symbols: GADD45A
• Host Species: Mouse
• Immunogen: GADD45A (AAH11757, 76 a.a. ∼ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1647
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ