Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123133

GAL, Mouse, Clone: 3C1-G5, Abnova™

Catalog No. 89123133 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-133 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-133 Supplier Abnova Corporation Supplier No. H00051083M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant GAL.

Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions (Mechenthaler, 2008 [PubMed 18500643]).[supplied by OMIM

Sequence: MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Specifications

Antigen GAL
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3C1-G5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant GAL.
Formulation ascites with no preservative
Gene GAL
Gene Accession No. BC030241
Gene Alias GALN/GLNN/GMAP/MGC40167
Gene Symbols GAL
Host Species Mouse
Immunogen GAL (AAH30241, 1 a.a. ∼ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51083
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.