Galectin-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159002

Catalog No. NBP159002

Description

Galectin-1 Polyclonal specifically detects Galectin-1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Galectin-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 14 kDa laminin-binding protein, 14 kDa lectin, Beta-galactoside-binding lectin L-14-I, DKFZp686E23103, gal-1, GAL1, Galaptin, galectin 1, galectin-1, GBP, HBL, HLBP14, HPL, Lactose-binding lectin 1, Lectin galactoside-binding soluble 1, lectin, galactoside-binding, soluble, 1, Putative MAPK-activating protein PM12, S-Lac lectin 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected to cross react based on sequence identity: Rabbit: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P09382
• Gene Symbols: LGALS1
• Immunogen: Synthetic peptides corresponding to LGALS1 (lectin, galactoside-binding, soluble, 1 (galectin-1)) The peptide sequence was selected from the middle region of LGALS1. Peptide sequence EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM.
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 3956
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only