Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89019024

glyceraldehyde-3-phosphate dehydrogenase, Mouse, Clone: 1G5, Abnova™

Catalog No. 89019024 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-019-024 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-019-024 Supplier Abnova Corporation Supplier No. H00002597M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant GAPDH.

The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq

Sequence: GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Specifications

Antigen glyceraldehyde-3-phosphate dehydrogenase
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1G5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GAPDH.
Formulation PBS with no preservative; pH 7.4
Gene GAPDH
Gene Accession No. NM_002046
Gene Alias G3PD/GAPD/MGC88685
Gene Symbols GAPDH
Host Species Mouse
Immunogen GAPDH (NP_002037, 226 a.a. ∼ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Stem Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 2597
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.