Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GAS2, Mouse, Clone: 4E11, Abnova™

Catalog No. 89022270 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-270 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-270 Supplier Abnova Corporation Supplier No. H00002620M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant GAS2.

The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq

Sequence: MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR

Specifications

Antigen GAS2
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4E11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GAS2.
Formulation PBS with no preservative; pH 7.4
Gene GAS2
Gene Accession No. NM_005256
Gene Alias MGC32610
Gene Symbols GAS2
Host Species Mouse
Immunogen GAS2 (NP_005247, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2620
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.